|
|
|
||||
|
Welcome to the GoFuckYourself.com - Adult Webmaster Forum forums. You are currently viewing our boards as a guest which gives you limited access to view most discussions and access our other features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload content and access many other special features. Registration is fast, simple and absolutely free so please, join our community today! If you have any problems with the registration process or your account login, please contact us. |
![]() |
|
|||||||
| Discuss what's fucking going on, and which programs are best and worst. One-time "program" announcements from "established" webmasters are allowed. |
|
|
Thread Tools |
|
|
#1 |
|
Confirmed User
Join Date: Feb 2007
Posts: 125
|
Please Appraise My New Domain Name Slamming.org
Slamming.org
I will be putting this on sedo I believe, unless people are interested here.. |
|
|
|
|
|
#2 |
|
Confirmed User
Join Date: Jan 2003
Posts: 7,006
|
nothing special.
Maybe mid XXX |
|
|
|
|
|
#3 |
|
Confirmed User
Join Date: Feb 2007
Posts: 125
|
|
|
|
|
|
|
#4 |
|
North Coast Pimp
Join Date: Dec 2005
Location: 304-534-757
Posts: 9,395
|
Only good for a organization that likes to slam stuff around... other then that useless!
|
|
|
|
|
|
#5 |
|
Confirmed User
Join Date: Feb 2007
Posts: 125
|
yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX
do you know how many people say slamming in hip-hop? or wrestling? also can be used for a porn site like slamming that ass... your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it. |
|
|
|
|
|
#6 |
|
Confirmed User
Join Date: Feb 2007
Posts: 125
|
I thought this was pretty funny...from overture
Count Search Term 2941 slamming 204 leech slamming 178 pussy slamming 142 slamming pervert 131 ass slamming 73 slamming door 53 chem slamming 51 pervert pig sex slamming 46 cock slamming 43 anal slamming 40 door our screen slamming song 35 cervix slamming 32 slamming gay 30 slamming spam 29 phone slamming 28 slamming teen |
|
|
|
|
|
#7 | |
|
Confirmed User
Join Date: Jan 2003
Posts: 7,006
|
Quote:
jeeze, calm down noob. You asked for people's opinions. If you wanted people to tell you what you wanted to hear, shoulda said so ![]() |
|
|
|
|
|
|
#8 |
|
boots are my religion
Join Date: Nov 2005
Location: Heart of europe
Posts: 21,765
|
|
|
|
|
|
|
#9 | |
|
Confirmed User
Join Date: Aug 2006
Posts: 304
|
Quote:
200k dollars! I guess my opinion counts? Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine. Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org. I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently. My 2 cents |
|
|
|
|
|
|
#10 | |
|
Confirmed User
Join Date: Dec 2001
Location: London Town
Posts: 2,924
|
Quote:
Oh and its a not bad dot org. high $XX to low $XXX.
__________________
ICQ 1454 81 522 |
|
|
|
|
|
|
|
#11 |
|
Confirmed User
Industry Role:
Join Date: May 2001
Posts: 9,240
|
lol i'm pretty sure I own slamming.com...
any offers? |
|
|
|
|
|
#12 |
|
Confirmed User
Industry Role:
Join Date: May 2001
Posts: 9,240
|
yep it's mine
|
|
|
|