Quote:
Originally Posted by italianmick69
your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.
|
If his opinion does not count, why did you ask for an appraisal?
200k dollars!
I guess my opinion counts?
Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine.
Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org.
I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently.
My 2 cents