GoFuckYourself.com - Adult Webmaster Forum

GoFuckYourself.com - Adult Webmaster Forum (https://gfy.com/index.php)
-   Fucking Around & Business Discussion (https://gfy.com/forumdisplay.php?f=26)
-   -   Please Appraise My New Domain Name Slamming.org (https://gfy.com/showthread.php?t=708518)

italianmick69 02-22-2007 12:58 AM

Please Appraise My New Domain Name Slamming.org
 
Slamming.org

I will be putting this on sedo I believe, unless people are interested here..

sharp 02-22-2007 12:59 AM

nothing special. :2 cents:
Maybe mid XXX

italianmick69 02-22-2007 01:03 AM

:thumbsup

Jon Clark - BANNED FOR LIFE 02-22-2007 01:12 AM

Only good for a organization that likes to slam stuff around... other then that useless!

italianmick69 02-22-2007 01:15 AM

yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


do you know how many people say slamming in hip-hop?
or wrestling?

also can be used for a porn site like slamming that ass...


your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.

italianmick69 02-22-2007 01:20 AM

I thought this was pretty funny...from overture

Count Search Term
2941 slamming
204 leech slamming
178 pussy slamming
142 slamming pervert
131 ass slamming
73 slamming door
53 chem slamming
51 pervert pig sex slamming
46 cock slamming
43 anal slamming
40 door our screen slamming song
35 cervix slamming
32 slamming gay
30 slamming spam
29 phone slamming
28 slamming teen

sharp 02-22-2007 01:23 AM

Quote:

Originally Posted by italianmick69 (Post 11956274)
yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


do you know how many people say slamming in hip-hop?
or wrestling?

also can be used for a porn site like slamming that ass...


your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.


jeeze, calm down noob. You asked for people's opinions. If you wanted people to tell you what you wanted to hear, shoulda said so :2 cents:

bobby666 02-22-2007 01:29 AM

:thumbsup :thumbsup :thumbsup

SabrinaDeep 02-22-2007 01:45 AM

Quote:

Originally Posted by italianmick69 (Post 11956274)
your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.

If his opinion does not count, why did you ask for an appraisal?

200k dollars!

I guess my opinion counts?

Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine.

Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org.

I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently.

My 2 cents

Mike Semen 02-22-2007 02:20 AM

Quote:

Originally Posted by italianmick69 (Post 11956284)
I thought this was pretty funny...from overture

Count Search Term

51 pervert pig sex slamming

WTF!!!!!:Oh crap

Oh and its a not bad dot org. high $XX to low $XXX.

dig420 02-22-2007 04:16 AM

lol i'm pretty sure I own slamming.com...

any offers?

dig420 02-22-2007 04:17 AM

yep it's mine


All times are GMT -7. The time now is 03:49 PM.

Powered by vBulletin® Version 3.8.8
Copyright ©2000 - 2026, vBulletin Solutions, Inc.
©2000-, AI Media Network Inc123