![]() |
Please Appraise My New Domain Name Slamming.org
Slamming.org
I will be putting this on sedo I believe, unless people are interested here.. |
nothing special. :2 cents:
Maybe mid XXX |
:thumbsup
|
Only good for a organization that likes to slam stuff around... other then that useless!
|
yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX
do you know how many people say slamming in hip-hop? or wrestling? also can be used for a porn site like slamming that ass... your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it. |
I thought this was pretty funny...from overture
Count Search Term 2941 slamming 204 leech slamming 178 pussy slamming 142 slamming pervert 131 ass slamming 73 slamming door 53 chem slamming 51 pervert pig sex slamming 46 cock slamming 43 anal slamming 40 door our screen slamming song 35 cervix slamming 32 slamming gay 30 slamming spam 29 phone slamming 28 slamming teen |
Quote:
jeeze, calm down noob. You asked for people's opinions. If you wanted people to tell you what you wanted to hear, shoulda said so :2 cents: |
:thumbsup :thumbsup :thumbsup
|
Quote:
200k dollars! I guess my opinion counts? Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine. Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org. I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently. My 2 cents |
Quote:
Oh and its a not bad dot org. high $XX to low $XXX. |
lol i'm pretty sure I own slamming.com...
any offers? |
yep it's mine
|
| All times are GMT -7. The time now is 03:49 PM. |
Powered by vBulletin® Version 3.8.8
Copyright ©2000 - 2026, vBulletin Solutions, Inc.
©2000-, AI Media Network Inc123