|
|
|
||||
|
Welcome to the GoFuckYourself.com - Adult Webmaster Forum forums. You are currently viewing our boards as a guest which gives you limited access to view most discussions and access our other features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload content and access many other special features. Registration is fast, simple and absolutely free so please, join our community today! If you have any problems with the registration process or your account login, please contact us. |
![]() |
|
|||||||
| Discuss what's fucking going on, and which programs are best and worst. One-time "program" announcements from "established" webmasters are allowed. |
|
|
Thread Tools |
|
|
#1 |
|
www.barely18movies.com
Join Date: Feb 2003
Location: Melbourne, Australia
Posts: 10,920
|
i'm selling the best domain name ever existed...
__________________
|
|
|
|
|
|
#2 |
|
Too lazy to set a custom title
Join Date: Apr 2004
Location: Buffalo, NY
Posts: 35,218
|
damn what a deal what are the type ins like?
|
|
|
|
|
|
#3 |
|
Too lazy to set a custom title
Join Date: Mar 2004
Posts: 10,579
|
great domain for sure
__________________
![]()
|
|
|
|
|
|
#4 |
|
Confirmed User
Industry Role:
Join Date: Aug 2004
Location: BASS
Posts: 3,168
|
hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour 20k SE hits a day!
__________________
![]() » AIM: slapdotted » Skype: slapdot » ICQ: 190444 |
|
|
|
|
|
#5 |
|
Affiliate
Join Date: Jul 2004
Posts: 28,735
|
lol... 2000 typins per hour... that would make this world a sick place!!
__________________
M&A Queen |
|
|
|
|
|
#6 |
|
www.barely18movies.com
Join Date: Feb 2003
Location: Melbourne, Australia
Posts: 10,920
|
mine does 10k type in's a hour not to mention i promote supertwink with a ratio of 1:3
__________________
|
|
|
|
|
|
#7 |
|
Confirmed User
Industry Role:
Join Date: Sep 2002
Location: In your mind
Posts: 3,766
|
those are the biggest boobs ive ever seen in an asian
|
|
|
|