Thread: i'm selling the best domain name ever existed...
View Single Post
Old 01-22-2005, 08:58 PM  
Slap Dot
Confirmed User
 
Slap Dot's Avatar
 
Industry Role:
Join Date: Aug 2004
Location: BASS
Posts: 3,168
hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour
20k SE hits a day!
__________________

» AIM: slapdotted
» Skype: slapdot
» ICQ: 190444
Slap Dot is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote