GoFuckYourself.com - Adult Webmaster Forum - i'm selling the best domain name ever existed...

- Fucking Around & Business Discussion (https://gfy.com/forumdisplay.php?f=26)

- - i'm selling the best domain name ever existed... (https://gfy.com/showthread.php?t=420748)

dunefield

01-22-2005 08:55 PM

i'm selling the best domain name ever existed...

xclusive

01-22-2005 08:56 PM

damn what a deal what are the type ins like?

tungsten

01-22-2005 08:57 PM

great domain for sure :disgust

Slap Dot

01-22-2005 08:58 PM

hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour
20k SE hits a day!

Violetta

01-22-2005 08:59 PM

lol... 2000 typins per hour... that would make this world a sick place!!

dunefield

01-22-2005 09:00 PM

mine does 10k type in's a hour not to mention i promote supertwink with a ratio of 1:3

d00t	01-22-2005 09:08 PM

those are the biggest boobs ive ever seen in an asian

All times are GMT -7. The time now is 06:20 AM.