GoFuckYourself.com - Adult Webmaster Forum

GoFuckYourself.com - Adult Webmaster Forum (https://gfy.com/index.php)
-   Fucking Around & Business Discussion (https://gfy.com/forumdisplay.php?f=26)
-   -   i'm selling the best domain name ever existed... (https://gfy.com/showthread.php?t=420748)

dunefield 01-22-2005 08:55 PM

i'm selling the best domain name ever existed...
 
www.hallahmadingding.com

700k

xclusive 01-22-2005 08:56 PM

damn what a deal what are the type ins like?

tungsten 01-22-2005 08:57 PM

great domain for sure :disgust

Slap Dot 01-22-2005 08:58 PM

hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour
20k SE hits a day!

Violetta 01-22-2005 08:59 PM

lol... 2000 typins per hour... that would make this world a sick place!!

dunefield 01-22-2005 09:00 PM

mine does 10k type in's a hour not to mention i promote supertwink with a ratio of 1:3

d00t 01-22-2005 09:08 PM

those are the biggest boobs ive ever seen in an asian


All times are GMT -7. The time now is 12:54 PM.

Powered by vBulletin® Version 3.8.8
Copyright ©2000 - 2026, vBulletin Solutions, Inc.
©2000-, AI Media Network Inc123