![]() |
i'm selling the best domain name ever existed...
|
damn what a deal what are the type ins like?
|
great domain for sure :disgust
|
hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour 20k SE hits a day! |
lol... 2000 typins per hour... that would make this world a sick place!!
|
mine does 10k type in's a hour not to mention i promote supertwink with a ratio of 1:3
|
those are the biggest boobs ive ever seen in an asian
|
| All times are GMT -7. The time now is 07:38 AM. |
Powered by vBulletin® Version 3.8.8
Copyright ©2000 - 2025, vBulletin Solutions, Inc.
©2000-, AI Media Network Inc123