Welcome to the GoFuckYourself.com - Adult Webmaster Forum forums.

You are currently viewing our boards as a guest which gives you limited access to view most discussions and access our other features. By joining our free community you will have access to post topics, communicate privately with other members (PM), respond to polls, upload content and access many other special features. Registration is fast, simple and absolutely free so please, join our community today!

If you have any problems with the registration process or your account login, please contact us.

Post New Thread Reply

Register GFY Rules Calendar Mark Forums Read
Go Back   GoFuckYourself.com - Adult Webmaster Forum > >
Discuss what's fucking going on, and which programs are best and worst. One-time "program" announcements from "established" webmasters are allowed.

 
Thread Tools
Old 01-22-2005, 08:55 PM   #1
dunefield
www.barely18movies.com
 
dunefield's Avatar
 
Join Date: Feb 2003
Location: Melbourne, Australia
Posts: 10,920
i'm selling the best domain name ever existed...

www.hallahmadingding.com

700k
__________________
dunefield is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 08:56 PM   #2
xclusive
Too lazy to set a custom title
 
Join Date: Apr 2004
Location: Buffalo, NY
Posts: 35,218
damn what a deal what are the type ins like?
__________________

I support MediumPimpin.com / Shemp's Outlawtgp.com /


xclusive is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 08:57 PM   #3
tungsten
Too lazy to set a custom title
 
Join Date: Mar 2004
Posts: 10,579
great domain for sure
__________________
  • VOYEUR /HOMEMADE, HENTAI / CARTOON, Reality, Amateur, Shemale, Hardcore, Cuckold, Celebrity, Retro/Vintage, ect...ALL OUR SITES >>
  • Unbelievable Ratio | High % of Rebills | Bi-Monthly Payments (also to E-Passporte)
  • Ton's of EXCLUSIVE Free content & FHG's |=> GREAT REVENUE $$$ GUARANTEED!
tungsten is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 08:58 PM   #4
Slap Dot
Confirmed User
 
Slap Dot's Avatar
 
Industry Role:
Join Date: Aug 2004
Location: BASS
Posts: 3,168
hotnakedchickspaysitewithtraffictrades2.com 500k
2,000 type ins every hour
20k SE hits a day!
__________________

» AIM: slapdotted
» Skype: slapdot
» ICQ: 190444
Slap Dot is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 08:59 PM   #5
Violetta
Affiliate
 
Violetta's Avatar
 
Join Date: Jul 2004
Posts: 28,735
lol... 2000 typins per hour... that would make this world a sick place!!
__________________
M&A Queen
Violetta is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 09:00 PM   #6
dunefield
www.barely18movies.com
 
dunefield's Avatar
 
Join Date: Feb 2003
Location: Melbourne, Australia
Posts: 10,920
mine does 10k type in's a hour not to mention i promote supertwink with a ratio of 1:3
__________________
dunefield is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Old 01-22-2005, 09:08 PM   #7
d00t
Confirmed User
 
Industry Role:
Join Date: Sep 2002
Location: In your mind
Posts: 3,766
those are the biggest boobs ive ever seen in an asian
d00t is offline   Share thread on Digg Share thread on Twitter Share thread on Reddit Share thread on Facebook Reply With Quote
Post New Thread Reply
Go Back   GoFuckYourself.com - Adult Webmaster Forum > >

Bookmarks
Thread Tools



Advertising inquiries - marketing at gfy dot com

Contact Admin - Advertise - GFY Rules - Top

©2000-, AI Media Network Inc



Powered by vBulletin
Copyright © 2000- Jelsoft Enterprises Limited.