Please Appraise My New Domain Name Slamming.org

Collapse
X
Collapse
 
  • Page of 1
  • Time
  • Show
Clear All
new posts
Previous template Next
  • italianmick69
    Confirmed User
    • Feb 2007
    • 125
    #1

    Please Appraise My New Domain Name Slamming.org

    Slamming.org

    I will be putting this on sedo I believe, unless people are interested here..
    Tags: None
    • sharp
      Confirmed User
      • Jan 2003
      • 7006
      #2
      nothing special.
      Maybe mid XXX

        Comment

        • italianmick69
          Confirmed User
          • Feb 2007
          • 125
          #3

            Comment

            • Jon Clark - BANNED FOR LIFE
              North Coast Pimp
              • Dec 2005
              • 9395
              #4
              Only good for a organization that likes to slam stuff around... other then that useless!

                Comment

                • italianmick69
                  Confirmed User
                  • Feb 2007
                  • 125
                  #5
                  yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


                  do you know how many people say slamming in hip-hop?
                  or wrestling?

                  also can be used for a porn site like slamming that ass...


                  your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.

                    Comment

                    • italianmick69
                      Confirmed User
                      • Feb 2007
                      • 125
                      #6
                      I thought this was pretty funny...from overture

                      Count Search Term
                      2941 slamming
                      204 leech slamming
                      178 pussy slamming
                      142 slamming pervert
                      131 ass slamming
                      73 slamming door
                      53 chem slamming
                      51 pervert pig sex slamming
                      46 cock slamming
                      43 anal slamming
                      40 door our screen slamming song
                      35 cervix slamming
                      32 slamming gay
                      30 slamming spam
                      29 phone slamming
                      28 slamming teen

                        Comment

                        • sharp
                          Confirmed User
                          • Jan 2003
                          • 7006
                          #7
                          Originally posted by italianmick69
                          yeah john clark you are smart......its a great domain name for branding I guarantee I can get XXX-Low XXXX


                          do you know how many people say slamming in hip-hop?
                          or wrestling?

                          also can be used for a porn site like slamming that ass...


                          your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.

                          jeeze, calm down noob. You asked for people's opinions. If you wanted people to tell you what you wanted to hear, shoulda said so

                            Comment

                            • bobby666
                              boots are my religion
                              • Nov 2005
                              • 21765
                              #8

                                Comment

                                • SabrinaDeep
                                  Confirmed User
                                  • Aug 2006
                                  • 304
                                  #9
                                  Originally posted by italianmick69
                                  your opinion does not count as you have no clue how good of a domain name it really is, not saying its the best, but its good especially for the money I paid for it.
                                  If his opinion does not count, why did you ask for an appraisal?

                                  200k dollars!

                                  I guess my opinion counts?

                                  Unfortunately, if you sell it i'm afraid that Jon Clark figure is gonna be more realistic than mine.

                                  Look at slamming.com and slamming.net: they don't look like there were many craving for them, given the purpose they are used for. That should tell you a lot. Plus the keyword "slammin" searched 3000 times in a month might mean not more than 200 visitors a month. I say that it might, because probably a website about tennis called letsplaytenniswhenwefeellike.com with a page called slamming.html and the keyword "grand slam" showing in the content has more chances to be on top of SE than the website called slamming.org.

                                  I've been offered 1000 bucks for chemistries.org...should tell you all. It'll change, but right now this is the market. I'd suggest you to keep it and wait patiently.

                                  My 2 cents
                                  Fan$talker - Pornstars who fuck their fans
                                  ICQ# 304-624-368

                                    Comment

                                    • Mike Semen
                                      Confirmed User
                                      • Dec 2001
                                      • 2924
                                      #10
                                      Originally posted by italianmick69
                                      I thought this was pretty funny...from overture

                                      Count Search Term

                                      51 pervert pig sex slamming
                                      WTF!!!!!

                                      Oh and its a not bad dot org. high $XX to low $XXX.
                                      ICQ 1454 81 522 |

                                        Comment

                                        • dig420
                                          Confirmed User
                                          • May 2001
                                          • 9240
                                          #11
                                          lol i'm pretty sure I own slamming.com...

                                          any offers?

                                            Comment

                                            • dig420
                                              Confirmed User
                                              • May 2001
                                              • 9240
                                              #12
                                              yep it's mine

                                                Comment

                                                Previous template Next
                                                Working...